ST3GAL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ST3GAL3 Polyclonal antibody (24925-1-AP)

• Featured Product
• KD/KO Validated

ST3GAL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24925-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Alpha 2,3 ST 3, Sialyltransferase 6, SIAT6, ST3Gal III, ST3GAL3, ST3GALII, ST3GalIII, ST3N

• 

  WB analysis of mouse liver using 24925-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24925-1-AP (ST3GAL3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 24925-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24925-1-AP (ST3GAL3 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 24925-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 24925-1-AP (ST3GAL3 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ST3GAL3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24925-1-AP targets ST3GAL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20795

  Product name: Recombinant human ST3GAL3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 203-375 aa of BC050380

  Sequence: TTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

• Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 3
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 44-55 kDa
• GenBank Accession Number: BC050380
• Gene Symbol: ST3GAL3
• Gene ID (NCBI): 6487
• RRID: AB_2879799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q11203
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ST3GAL3 Polyclonal antibody (catalog number 24925-1-AP) has a total of 1 citation. It appears in FEBS Letters, in a 2018 study titled "The sialyltransferase ST3Gal3 facilitates the receptivity of the uterine endometrium in vitro and in vivo," where it was used for WB and IHC in human samples. The associated research field is reproductive biology, specifically uterine endometrial receptivity and sialyltransferase function.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	FEBS Lett; The sialyltransferase ST3Gal3 facilitates the receptivity of the uterine endometrium in vitro and in vivo.; Authors - Ming Yu ; KD Validated