ST3GAL5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ST3GAL5 Polyclonal antibody, PBS Only (30120-1-PBS)

• 

  WB analysis using 30120-1-AP (same clone as 30120-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30120-1-AP (ST3GAL5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30120-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 30120-1-AP (same clone as 30120-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using ST3GAL5 antibody (30120-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30120-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 30120-1-AP (same clone as 30120-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using ST3GAL5 antibody (30120-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30120-1-PBS in a different storage buffer formulation.

ST3GAL5 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30120-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30120-1-PBS targets ST3GAL5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32461

  Product name: Recombinant human ST3GAL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-418 aa of BC065936

  Sequence: YSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF

• Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 5
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC065936
• Gene Symbol: ST3GAL5
• Gene ID (NCBI): 8869
• RRID: AB_3086237
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNP4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ST3GAL5 is also named as SIAT9, GM3 synthase, ST3Gal V, Sialyltransferase 9 and belongs to the glycosyltransferase 29 family. ST3GAL5 transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose of glycosphingolipids forming gangliosides (PMID:9822625, PMID:16934889). SIAT9 is mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1) (PMID:16934889). ST3GAL5 is high expression in brain, skeletal muscle, placenta, and testis. And mRNA of ST3GAL5 is widely distributed in human brain, but slightly elevated expression was observed in the cerebral cortex, temporal lobe, and putamen (PMID:9822625). This antibody recognizes the glycosylated form of ST3GAL5 (PMID: 34943806, PMID: 26458842).