Tested Applications
| Positive WB detected in | HepG2 cells, HuH-7 cells, Jurkat cells, mouse spleen tissue, U-937 cells, L02 cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human colon cancer tissue, human ovary cancer tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14355-1-AP targets ST6GAL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5705 Product name: Recombinant human ST6GAL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-406 aa of BC040009 Sequence: SQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC Predict reactive species |
| Full Name | ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 43-45 kDa, 50-70 kDa |
| GenBank Accession Number | BC040009 |
| Gene Symbol | ST6GAL1 |
| Gene ID (NCBI) | 6480 |
| RRID | AB_2194422 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15907 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Western blot analysis of human liver using this antibody detects both isoforms between 43-50 kDa. Higher molecular weight of bands around 50-70 kDa can also be observed with glycosylation modification. (PMID: 15049997, 23358684)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ST6GAL1 antibody 14355-1-AP | Download protocol |
| IP protocol for ST6GAL1 antibody 14355-1-AP | Download protocol |
| WB protocol for ST6GAL1 antibody 14355-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Immunity Immune checkpoint therapy-elicited sialylation of IgG antibodies impairs antitumorigenic type I interferon responses in hepatocellular carcinoma | ||
Int J Cancer Modification of α2,6-sialylation mediates the invasiveness and tumorigenicity of non-small cell lung cancer cells in vitro and in vivo via Notch1/Hes1/MMPs pathway.
| ||
Mol Cell Proteomics Integrated Systems Analysis of the Murine and Human Pancreatic Cancer Glycomes Reveals a Tumor-Promoting Role for ST6GAL1
| ||
Front Oncol High-Risk HPV16 E6 Activates the cGMP/PKG Pathway Through Glycosyltransferase ST6GAL1 in Cervical Cancer Cells.
| ||
Am J Cancer Res α1,6-Fucosyltransferase (FUT8) regulates the cancer-promoting capacity of cancer-associated fibroblasts (CAFs) by modifying EGFR core fucosylation (CF) in non-small cell lung cancer (NSCLC). | ||
Int J Food Sci Nutr Ellagic acid alleviates TNBS-induced intestinal barrier dysfunction by regulating mucin secretion and maintaining tight junction integrity in rats |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (04-23-2024) | The strong band around 60 kd is a non-specific band. 1) This band doesn't respond to RNAi (I have another St6gal1 antibody which can confirm the RNAi was working), and 2) this band doesn't respond to PNGase deglycosylation (St6gal1 carries glycosylation, which should show a downshift after PNGase treatment).
|
Vanessa (Verified Customer) (01-12-2024) | 1:1000 dilution of the primary antibody accompanied by the recommended blocking, washing and incubation steps resulted in crisp bands with no background.
|
Maggie (Verified Customer) (11-15-2023) | Overnight incubation
![]() |
Faezeh (Verified Customer) (01-29-2023) | It showed two bands in A549 and PANC1 cell lines, we validated that top band is the correct one using siRNA against ST6GAL1.
![]() |
Dawn (Verified Customer) (02-22-2022) | It is difficult to find good antibodies for glycoslytransferase genes, but this is a good one. It works in multiple cell lines as well.
|
Patricia (Verified Customer) (02-25-2020) | Did not work- even for positive control
|



























