ST6GAL1 Monoclonal antibody, PBS Only

ST6GAL1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68633-1-PBS
Clone No.1F11G5

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, Indirect ELISA

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, CD75, Beta-galactoside alpha-2,6-sialyltransferase 1, B-cell antigen CD75, Alpha 2,6-ST 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68633-1-PBS targets ST6GAL1 in WB, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6181

Product name: Recombinant human ST6GAL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 60-406 aa of BC040009

Sequence: SQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Predict reactive species
Full Name ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 43-45 kDa, 50-70 kDa
GenBank Accession NumberBC040009
Gene Symbol ST6GAL1
Gene ID (NCBI) 6480
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15907
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Western blot analysis of human liver using this antibody detects both isoforms between 43-50 kDa. Higher molecular weight of bands around 50-70 kDa can also be observed with unknown reason. (PMID: 15049997)

Loading...
||
New chat Able
正在加载,请稍候...