ST6GAL2 Polyclonal antibody

• 

  WB analysis using 28367-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28367-1-AP (ST6GAL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 28367-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 28367-1-AP (ST6GAL2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ST6GAL2 Polyclonal Antibody for WB, ELISA

Cat No. 28367-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, ELISA

Synonyms

Alpha 2,6 ST 2, FLJ30711, FLJ37730, FLJ38334, hST6Gal II, KIAA1877, Sialyltransferase 2, SIAT2, ST6Gal II, ST6GAL2, ST6GalII

---

Tested Applications

• Positive WB detected in: HL-60 cells, RAW 264.7 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:300-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28367-1-AP targets ST6GAL2 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26357

  Product name: Recombinant human ST6GAL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-200 aa of BC008680

  Sequence: SNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQRRSHVLEEGDDGDRLYSSMSRAFLYRLWKGN

• Full Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
• Calculated Molecular Weight: 529 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008680
• Gene Symbol: ST6GAL2
• Gene ID (NCBI): 84620
• RRID: AB_2881124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JF0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Inflamm Res; Downregulation of ST6GAL2 Correlates to Liver Inflammation and Predicts Adverse Prognosis in Hepatocellular Carcinoma; Authors - Ruijia Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Faezeh (Verified Customer) (01-29-2023)

It shows a right band size in A549 and HT-29 cell lines.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: A549 cell line

ST6GAL2 Antibody Western Blot validation (1:1000 dilution) in A549 cell line (Cat no:28367-1-AP)