ST6GALNAC4 Polyclonal antibody

• 

  IP experiment of HeLa using 15654-1-AP

  IP result of anti-ST6GALNAC4 (IP:15654-1-AP, 4ug; Detection:15654-1-AP 1:300) with HeLa cells lysate 980 ug.

ST6GALNAC4 Polyclonal Antibody for IP, ELISA

Cat No. 15654-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, ELISA

Synonyms

Sialyltransferase 3C, Sialyltransferase 7D, SIAT3 C, SIAT3C, SIAT7 D, SIAT7D, ST6GalNAc IV, ST6GALNAC4, ST6GALNACIV

---

Tested Applications

• Positive IP detected in: HeLa cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15654-1-AP targets ST6GALNAC4 in IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7995

  Product name: Recombinant human ST6GALNAC4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-302 aa of BC036705

  Sequence: MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRSCAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRTE

• Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC036705
• Gene Symbol: ST6GALNAC4
• Gene ID (NCBI): 27090
• RRID: AB_3669218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4F1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase (also known as ST6GALNAC4) is a member of the sialyltransferases, which catalyzes the transfer of sialic acid from cytidine monosphosphate (CMP)-sialic acid to galactose-containing substrates. ST6GALNAC4 may be induced abnormal TGFBR2 glycosylation, resulting in the higher protein levels of TGFBR2 and TGF pathway increased activation (PMID: 37381011, 37034303). ST6GALNAC4 was reported to influence patient prognosis though subverting immunosurveillance in Chronic lymphocytic leukemia.