ST8SIA4 Polyclonal antibody

• 

ST8SIA4 Polyclonal Antibody for ELISA

Cat No. 13134-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

Alpha 2,8 sialyltransferase 8D, Polysialyltransferase 1, PST, PST1, Sialyltransferase 8D, Sialytransferase St8Sia IV, SIAT8 D, SIAT8D, ST8SIA IV, ST8SIA4, ST8SiaIV

---

Product Information

13134-1-AP targets ST8SIA4 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3815

  Product name: Recombinant human ST8SIA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC027866

  Sequence: MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR

• Full Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
• Calculated Molecular Weight: 359 aa, 41 kDa
• GenBank Accession Number: BC027866
• Gene Symbol: ST8SIA4
• Gene ID (NCBI): 7903
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92187
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.