STAC2 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 24274-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 24274-1-AP (STAC2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 24274-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 24274-1-AP (STAC2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate hyperplasia using 24274-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia slide using 24274-1-AP (STAC2 Antibody) at dilution of 1:50.

• 

  IHC staining of human prostate hyperplasia using 24274-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia slide using 24274-1-AP (STAC2 Antibody) at dilution of 1:50.

STAC2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24274-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

24b2, 24b2/STAC2, SH3 and cysteine rich domain 2, STAC2

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IHC detected in: human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24274-1-AP targets STAC2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17976

  Product name: Recombinant human STAC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 65-154 aa of BC109231

  Sequence: TLRYGTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQQLPKATLRKDVGPMYS

• Full Name: SH3 and cysteine rich domain 2
• Calculated Molecular Weight: 411 aa, 45 kDa
• Observed Molecular Weight: 42-45 kDa
• GenBank Accession Number: BC109231
• Gene Symbol: STAC2
• Gene ID (NCBI): 342667
• RRID: AB_2879464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZMT1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.