Use Able AI chat for product recommendations

STAG1 Polyclonal antibody

STAG1 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

His SA, Cohesin subunit SA 1, Cohesin subunit SA-1, SA1, SCC3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for STAG1 in ?

Tested Applications

Positive WB detected inHEK-293T cells, HeLa cells, human heart tissue, Raji cells, Jurkat cells, MCF-7 cells, NIH/3T3 cells
Positive IHC detected inhuman stomach tissue, human ovary cancer tissue, rat liver tissue, rat brain tissue, rat kidney tissue, mouse brain tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14015-1-AP targets STAG1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5123

Product name: Recombinant human STAG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 880-1221 aa of BC064699

Sequence: IVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEHGSEPDFLHNRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF

Predict reactive species
Full Name stromal antigen 1
Calculated Molecular Weight 144 kDa
Observed Molecular Weight 155 kDa
GenBank Accession NumberBC064699
Gene Symbol STAG1
Gene ID (NCBI) 10274
RRIDAB_2194759
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WVM7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAG1, also named as SCC3 homolog 1, is a 1258 amino acid protein, which belongs to the SCC3 family. STAG1 interacts directly with RAD21 in cohesin complex and localizes in nucleus. STAG1 is a Component of cohesin complex, which is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. The calculate molecular weight of STAG1 is 144 kDa, but modified STAG1 is about 145-150 kDa.

Protocols

Product Specific Protocols
IHC protocol for STAG1 antibody 14015-1-APDownload protocol
WB protocol for STAG1 antibody 14015-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The STAG1 Polyclonal antibody (Cat# 14015-1-AP) has 5 citations published in Bone Research, PNAS, bioRxiv, Molecular Cell, and Molecular Biology of the Cell. The associated research fields include bone regeneration via circRNA-HuR interaction, cancer driver genetics and PD-L1 regulation, CENP-A chromatin incorporation independent of transcription, and cohesin-mediated mitotic functions including transcriptional restart.

SpeciesApplicationTitle
ratWB

Bone Res

Circular RNA circStag1 promotes bone regeneration by interacting with HuR.

Authors - Gaoyang Chen
humanWB

Proc Natl Acad Sci U S A

Genetic analysis of cancer drivers reveals cohesin and CTCF as suppressors of PD-L1.

Authors - Ena Oreskovic
humanWB

bioRxiv

Robust CENP-A incorporation in human cells is independent of transcription and cohesin components.

Authors - Reito Watanabe

Mol Biol Cell

Robust CENP-A incorporation in human cells is independent of transcription and cohesin components.

Authors - Reito Watanabe
humanWB,IF

Mol Cell

Cohesin preservation across mitosis contributes to restart transcription via Cdk9-mediated activation of RNAPol2.

Authors - Aida Contreras-Pérez
Loading...
||
New chat

Able™

正在加载,请稍候...