STAM Monoclonal antibody, PBS Only

• 

  WB analysis using 68628-1-Ig (same clone as 68628-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68628-1-Ig (STAM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68628-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 68628-1-Ig (same clone as 68628-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 68628-1-Ig (STAM antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68628-1-PBS in a different storage buffer formulation.

STAM Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68628-1-PBS

Clone No.1F5C2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

DKFZp686J2352, STAM, STAM 1, STAM1

---

Product Information

68628-1-PBS targets STAM in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33192

  Product name: Recombinant human STAM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 54-403 aa of BC030586

  Sequence: VNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS

• Full Name: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC030586
• Gene Symbol: STAM
• Gene ID (NCBI): 8027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92783
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STAM, also named as STAM1, belongs to the STAM family. It is involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. STAM may also play a role in T-cell development. It is involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs). Together with HRS, STAM forms ESCRT-0. STAM was originally identified as an adaptor protein involved in cytokine signaling.(PMID:20505072)