Filter: AllWBIPIHCIF/ICCChIP-qPCRAffinity

WB analysis using 82016-1-RR (same clone as 82016-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 82016-1-RR (STAT1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 82016-1-RR (same clone as 82016-1-PBS)
WB result of STAT1 antibody (82016-1-RR; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STAT1 transfected HEK-293 cells. This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IP experiment of PC-3 using 82016-1-RR (same clone as 82016-1-PBS)
IP result of anti-STAT1 (IP:82016-1-RR, 4ug; Detection:82016-1-RR 1:10000) with PC-3 cells lysate 2000 ug. This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 82016-1-RR (same clone as 82016-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 82016-1-RR (STAT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 82016-1-RR (same clone as 82016-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 82016-1-RR (STAT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 82016-1-RR (same clone as 82016-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 82016-1-RR (STAT1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IHC staining of rat colon using 82016-1-RR (same clone as 82016-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 82016-1-RR (STAT1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IHC staining of rat spleen using 82016-1-RR (same clone as 82016-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 82016-1-RR (STAT1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 82016-1-RR (same clone as 82016-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 82016-1-RR (STAT1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 82016-1-RR (same clone as 82016-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed IFN alpha treated HeLa cells using STAT1 antibody (82016-1-RR, Clone: 2F16 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
ChIP experiment of HT-1080 using 82016-1-RR (same clone as 82016-1-PBS)
Chromatin was prepared from HT-1080 cells either non-treated or treated with hIFN-γ (50 ng/ml, 30min). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of STAT1 (82016-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
×
Chromatin was prepared from HT-1080 cells either non-treated or treated with hIFN-γ (50 ng/ml, 30min). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of STAT1 (82016-1-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR. This data was developed using the same antibody clone with 82016-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 82016-1-RR
Biolayer interferometry (BLl) kinetic assays of 82016-1-RR against Human STAT1 were performed. The affinity constant is 0.501 nM.

Featured Product
KD/KO Validated

STAT1 Recombinant monoclonal antibody, PBS Only

STAT1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA, ChIP-qPCR

Cat No. 82016-1-PBS

Clone No.2F16

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA, ChIP-qPCR

Synonyms

2F16, ISGF 3, Signal transducer and activator of transcription 1-alpha/beta, STAT91, Transcription factor ISGF-3 components p91/p84

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

82016-1-PBS targets STAT1 in WB, IHC, IF/ICC, IP, Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA Predict reactive species
Full Name	signal transducer and activator of transcription 1, 91kDa
Calculated Molecular Weight	83 kDa
Observed Molecular Weight	84 kDa
GenBank Accession Number	BC002704
Gene Symbol	STAT1
Gene ID (NCBI)	6772
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P42224
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

STAT1 (signal transducers and activators of transcription 1) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. Various ligands, including interferons- and - , EGF, PDGF and IL-6, can activate STAT1. STAT1 protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.