STAT5A/B Polyclonal antibody

STAT5A/B Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 12071-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

STAT5B, STAT5

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, K-562 cells, MOLT-4 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman cervical cancer tissue, human lung cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12071-1-AP targets STAT5A/B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2709

Product name: Recombinant human STAT5B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC020868

Sequence: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT

Predict reactive species
Full Name signal transducer and activator of transcription 5B
Calculated Molecular Weight 787 aa, 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC020868
Gene Symbol STAT5B
Gene ID (NCBI) 6777
ENSEMBL Gene IDENSG00000173757
RRIDAB_2196933
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP51692
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAT5B belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5B carries out a dual function: signal transduction and activation of transcription. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Although this antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human STAT5B, the homology between this segment and the corresponding segment of human STAT5A is 95%. It shows that this antibody can cross-react with STAT5A.

Protocols

Product Specific Protocols
WB protocol for STAT5A/B antibody 12071-1-APDownload protocol
IHC protocol for STAT5A/B antibody 12071-1-APDownload protocol
IF protocol for STAT5A/B antibody 12071-1-APDownload protocol
IP protocol for STAT5A/B antibody 12071-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Biomed Pharmacother

Kuijieling regulates the differentiation of Treg and Th17 cells to ameliorate experimental colitis in rats.

Authors - Yu Long
mouseWB

Br J Pharmacol

HSP90β shapes the fate of Th17 cells with the help of glycolysis-controlled methylation modification

Authors - Ling Yang
ratWB, IP, IF

Toxicol Appl Pharmacol

PMID: 26493931

Authors - Furong Zhang
ratWB

Pharm Biol

Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF.

Authors - Ying Xu
mouseWB

Biochem Biophys Res Commun

1, 25(OH)2D3-induced interaction of vitamin D receptor with p50 subunit of NF-κB suppresses the interaction between KLF5 and p50, contributing to inhibition of LPS-induced macrophage proliferation.

Authors - Dong Ma
ratWB

Iran J Basic Med Sci

Quercetin of huoxuehuayu tongluo decoction and azithromycin combination therapy effectively improves rat tubal factor infertility by inhibiting inflammation

Authors - Liang Shao
Loading...
||
New chat Able
正在加载,请稍候...