STBD1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• STBD1 Recombinant monoclonal antibody (87526-1-RR)

STBD1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87526-1-RR

Clone No.252915D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Genethonin-1, GENX-3414, Glycophagy cargo receptor STBD1, starch binding domain 1, Starch-binding domain-containing protein 1

• 

  WB analysis using 87526-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87526-1-RR (STBD1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 87526-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using STBD1 antibody (87526-1-RR, Clone: 252915D10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87526-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87526-1-RR against Human STBD1 were performed. The affinity constant is 0.666 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, Caki-1 cells, HuH-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87526-1-RR targets STBD1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2481

  Product name: Recombinant human STBD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-358 aa of BC022301

  Sequence: GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH

• Full Name: starch binding domain 1
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 35-43 kDa
• GenBank Accession Number: BC022301
• Gene Symbol: STBD1
• Gene ID (NCBI): 8987
• RRID: AB_3745598
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95210
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STBD1 may have the capability to bind to carbohydrates. It functions as a glycogen receptor that tethers glycogen to autophagic membranes for delivery and breakdown in lysosomes. STBD1 appears molecular mass of 35-38 kDa band in mouse/rat tissues and 38-43 kDa in human tissue.