STBD1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP03085-1

  The mean STBD1 concentration was determined to be 8.8 ng/mL in LNCaP cell extract based on a 1.2 mg/mL extract load, 5.6 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, Jurkat cell extract were served as a negative control.

• 

  Cytometric bead array standard curve of MP03085-1

  Cytometric bead array standard curve of MP03085-1, STBD1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87526-3-PBS. Detection antibody: 87526-2-PBS. Standard: Ag2481. Range: 0.156-20 ng/mL.

STBD1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87526-3-PBS

Clone No.252915F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Genethonin-1, GENX-3414, Glycophagy cargo receptor STBD1, starch binding domain 1, Starch-binding domain-containing protein 1

---

Product Information

87526-3-PBS targets STBD1 as part of a matched antibody pair:

MP03085-1: 87526-3-PBS capture and 87526-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2481

  Product name: Recombinant human STBD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-358 aa of BC022301

  Sequence: GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH

• Full Name: starch binding domain 1
• Calculated Molecular Weight: 41 kDa
• GenBank Accession Number: BC022301
• Gene Symbol: STBD1
• Gene ID (NCBI): 8987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95210
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.