Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

STC1 Polyclonal antibody

STC1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 20621-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, IP, ELISA, Cell treatment

Stanniocalcin-1, STC, STC-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, SW480 cells, U-251 cells
Positive IP detected inSW480 cells
Positive IHC detected inhuman cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20621-1-AP targets STC1 in WB, IHC, IF, IP, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14697

Product name: Recombinant human STC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 98-247 aa of BC029044

Sequence: CIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

Predict reactive species
Full Name stanniocalcin 1
Calculated Molecular Weight 247 aa, 28 kDa
Observed Molecular Weight25-28 kDa
GenBank Accession NumberBC029044
Gene Symbol STC1
Gene ID (NCBI) 6781
RRIDAB_10694290
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP52823
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STC1, also named as stanniocalcin 1, a 56kDa homodimeric glycoprotein hormone, is highly expressed in a variety of cancers such as breast, ovarian, and colorectal cancers (PMID: 27459971). This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. STC1 is implicated in several pathologies including retinal degeneration, cerebral ischemia, angiogenesis and inflammation (PMID: 25391215). The calculated molecular weight of STC1 is usually approximately 28 kda.

Protocols

Product Specific Protocols
IHC protocol for STC1 antibody 20621-1-APDownload protocol
IP protocol for STC1 antibody 20621-1-APDownload protocol
WB protocol for STC1 antibody 20621-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Front Immunol

Identification of prognosis and therapy related intratumoral microbiome and immune signatures in gastric cancer

Authors - Peng Jin
humanIHC

Inflamm Bowel Dis

Pro-inflammatory Cytokines Promote the Occurrence and Development of Colitis-associated Colorectal Cancer by Inhibiting miR-615-5p

Authors - Danping Sun
humanWB

Life Sci

Adiponectin alleviates the symptoms of ischemic renal disease by inhibiting renal cell apoptosis.

Authors - Xiaotong Zheng
humanWB

Cancer Cell Int

PMID: 31889892

Authors - Chuanfeng Zhang
humanWB

Neurochem Res

Stanniocalcin-1 Protected Astrocytes from Hypoxic Damage Through the AMPK Pathway.

Authors - Binda Sun
  • KD Validated
humanWB

Cancer Biother Radiopharm

Sevoflurane Suppresses Glioma Cell Proliferation, Migration, and Invasion Both In Vitro and In Vivo Partially Via Regulating KCNQ1OT1/miR-146b-5p/STC1 Axis.

Authors - Jian Wen
Loading...
||
New chat

Able

正在加载,请稍候...