STC1 Polyclonal antibody

• 

  WB analysis using 20621-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20621-1-AP (STC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 20621-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 20621-1-AP (STC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 20621-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 20621-1-AP (STC1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

STC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20621-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA, Cell treatment

Synonyms

Stanniocalcin-1, STC, STC-1

---

Tested Applications

• Positive WB detected in: HCT 116 cells, SW480 cells, U-251 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 9 publications below
• IHC: See 6 publications below
• IP: See 1 publications below

Product Information

20621-1-AP targets STC1 in WB, IHC, IP, ELISA, Cell treatment applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14697

  Product name: Recombinant human STC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 98-247 aa of BC029044

  Sequence: CIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

• Full Name: stanniocalcin 1
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC029044
• Gene Symbol: STC1
• Gene ID (NCBI): 6781
• RRID: AB_10694290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52823
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STC1, also named as stanniocalcin 1, a 56kDa homodimeric glycoprotein hormone, is highly expressed in a variety of cancers such as breast, ovarian, and colorectal cancers (PMID: 27459971). This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. STC1 is implicated in several pathologies including retinal degeneration, cerebral ischemia, angiogenesis and inflammation (PMID: 25391215). The calculated molecular weight of STC1 is usually approximately 28 kda.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Inflamm Bowel Dis; Pro-inflammatory Cytokines Promote the Occurrence and Development of Colitis-associated Colorectal Cancer by Inhibiting miR-615-5p; Authors - Danping Sun
human	WB	Life Sci; Adiponectin alleviates the symptoms of ischemic renal disease by inhibiting renal cell apoptosis.; Authors - Xiaotong Zheng
human	WB	Cancer Cell Int; PMID: 31889892; Authors - Chuanfeng Zhang
human	WB	Neurochem Res; Stanniocalcin-1 Protected Astrocytes from Hypoxic Damage Through the AMPK Pathway.; Authors - Binda Sun ; KD Validated
human	IHC	Oncol Lett; Stanniocalcin 1 is a prognostic biomarker in glioma.; Authors - Weijian Luo
human	WB	Cancer Biother Radiopharm; Sevoflurane Suppresses Glioma Cell Proliferation, Migration, and Invasion Both In Vitro and In Vivo Partially Via Regulating KCNQ1OT1/miR-146b-5p/STC1 Axis.; Authors - Jian Wen