STEAP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STEAP3 Polyclonal antibody, PBS Only (28478-1-PBS)

• 

  WB analysis using 28478-1-AP (same clone as 28478-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28478-1-AP (STEAP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 28478-1-AP (same clone as 28478-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 28478-1-AP (STEAP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 28478-1-AP (same clone as 28478-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 28478-1-AP (STEAP3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 28478-1-AP (same clone as 28478-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 28478-1-AP (STEAP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 28478-1-AP (same clone as 28478-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 28478-1-AP (STEAP3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 28478-1-AP (same clone as 28478-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28478-1-AP (STEAP3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 28478-1-AP (same clone as 28478-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using STEAP3 antibody (28478-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28478-1-PBS in a different storage buffer formulation.

STEAP3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28478-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

28478-1-PBS targets STEAP3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29528

  Product name: Recombinant human STEAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-130 aa of BC042150

  Sequence: NPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNA

• Full Name: STEAP family member 3
• Calculated Molecular Weight: 488 aa, 55 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC042150
• Gene Symbol: STEAP3
• Gene ID (NCBI): 55240
• RRID: AB_3086055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q658P3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is also named as TSAP6, Dudulin-2 and pHyde, and belongs to the STEAP family. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).