Tested Applications
| Positive WB detected in | A549 cells, 3T3-L1 cells, rat liver tissue, human liver tissue, human brain tissue, RAW 264.7 cells |
| Positive IP detected in | 3T3-L1 cells |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11944-1-AP targets STEAP4 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2545 Product name: Recombinant human STEAP4 protein Source: e coli.-derived, T-GST Tag: GST Domain: 1-283 aa of BC020600 Sequence: MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH Predict reactive species |
| Full Name | STEAP family member 4 |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC020600 |
| Gene Symbol | STEAP4 |
| Gene ID (NCBI) | 79689 |
| RRID | AB_2197868 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q687X5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STEAP4 (also called STAMP2), is a member of the STEAP family. Structurally, It is a 459 amino acid protein characterized by a molecular topology of six transmembrane domains. The cytoplasmic N-terminal domain of STEAP4 shows structural similarity with bacterial and archaeal FNO oxidoreductase and STEAP4 exhibits a strong iron reductase activity. Studies in mice and human suggest that STEAP4 maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STEAP4 antibody 11944-1-AP | Download protocol |
| IHC protocol for STEAP4 antibody 11944-1-AP | Download protocol |
| IP protocol for STEAP4 antibody 11944-1-AP | Download protocol |
| WB protocol for STEAP4 antibody 11944-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-STEAP2 (STAMP2) antibody, catalog number 11944-1-AP, has 55 citations. These appear in journals including Nature Communications, Journal of Hepatology, Advanced Science, PNAS, EMBO Molecular Medicine, FASEB Journal, Cell Death & Disease, and PLoS ONE. Research fields span metabolism (NAFLD, insulin resistance, iron/copper homeostasis), oncology (prostate, liver, colon, breast, gastric cancer), inflammation, fibrosis, and cardiovascular/renal disease, with applications mainly in WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Bone Res Dietary fat-associated osteoarthritic chondrocytes gain resistance to lipotoxicity through PKCK2/STAMP2/FSP27.
| ||
Nat Commun Inflammation mobilizes copper metabolism to promote colon tumorigenesis via an IL-17-STEAP4-XIAP axis. | ||
Adv Sci (Weinh) Single-Cell Dissection of Therapy-Induced Remodeling Uncovers a Fibroblast-Driven Immunosuppressive Niche and Targetable Vulnerabilities in Lethal Prostate Cancer. | ||
Adv Sci (Weinh) Steap4 Promotes Senile Osteoporosis via Fe(2+)-ROS/C/EBPβ Feedback-Driven Ferroptosis and Adipogenesis in Senescent BMSCs. | ||
Cancer Biol Med VDAC1 protein derived from extracellular vesicles promotes paclitaxel resistance in gastric cancer through autophagy and mitophagy. |
Reviews
What customers say
The product has received one review, rated 5 stars. The reviewer reported that it "works pretty good" for Western Blot and Immunofluorescence applications. Overall, the feedback is positive, indicating satisfactory performance in these tested applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xiang (Verified Customer) (11-08-2019) | Works pretty good.
|
