STIP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• STIP1 Polyclonal antibody (15218-1-AP)

• Featured Product
• KD/KO Validated

STIP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15218-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Hop, Hsc70/Hsp90 organizing protein, Hsc70/Hsp90-organizing protein, IEF SSP 3521, P60

• 

  WB analysis using 15218-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15218-1-AP (STIP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15218-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15218-1-AP (STIP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 15218-1-AP

  WB result of STIP1 antibody (15218-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STIP1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 15218-1-AP

  IP result of anti-STIP1 (IP:15218-1-AP, 4ug; Detection:15218-1-AP 1:500) with Jurkat cells lysate 2400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 15218-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15218-1-AP (STIP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 15218-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 15218-1-AP (STIP1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 15218-1-AP

  Immunofluorescent analysis of MCF-7 cells, using STIP1 antibody 15218-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for STIP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, A549 cells, HEK-293 cells, HepG2 cells, Jurkat cells, HeLa cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human liver cancer tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15218-1-AP targets STIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7388

  Product name: Recombinant human STIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 195-543 aa of BC002987

  Sequence: EIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

• Full Name: stress-induced-phosphoprotein 1
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC002987
• Gene Symbol: STIP1
• Gene ID (NCBI): 10963
• RRID: AB_2255518
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31948
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STIP1, also named as Hop and NY-REN-11. Its expression is low in the hypothalamus. STIP1 has some isoforms with MW 62 kDa, 68 kDa and 59 kDa. Acts as a co-chaperone for HSP90AA1.Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90, Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. STIP1 interacts with PACRG, EEF1AKMT3, FLCN, FNIP1 and FNIP2 (PMID:24880080).

Publications

What published studies show

The anti-STIP1 antibody (Cat# 15218-1-AP) has 9 citations published in journals including Nature, Int J Biol Sci, EMBO Rep, Exp Cell Res, Mol Biol Cell, Hum Cell, Gene, and Cancer Manag Res. Research fields span Hsp90 chaperone-client loading mechanisms, hepatocellular carcinoma, diabetic cardiomyopathy, ER protein folding, gastric cancer, mitochondrial biogenesis, breast cancer progression, male reproductive stress response, and lung adenocarcinoma signaling.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.; Authors - Ray Yu-Ruei Wang
human	WB	Int J Biol Sci; O-GlcNAcylated RALY Contributes to Hepatocellular Carcinoma Cells Proliferation by Regulating USP22 mRNA Nuclear Export; Authors - Shiwei Liu
		Int J Biol Sci; Macrophage-derived S100A9 promotes diabetic cardiomyopathy by disturbing mitochondrial quality control via STAT3 activation; Authors - Shengqi Huo
mouse	WB,IP	EMBO Rep; Kinesin-1 mediates proper ER folding of the CaV1.2 channel and maintains mouse glucose homeostasis; Authors - Yosuke Tanaka
mouse,human	WB,IHC,IF	Exp Cell Res; Tumor-promoting action of ubiquitin protease 43 in gastric cancer progression through deubiquitination and stabilization of stress-inducible phosphoprotein 1; Authors - Zijun Guo
human	WB	Mol Biol Cell; Mechanism of chaperone recruitment and retention on mitochondrial precursors; Authors - Szymon Juszkiewicz