Tested Applications
| Positive WB detected in | SKOV-3 cells, A549 cells, COLO 320 cells |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25471-1-AP targets STK10 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22169 Product name: Recombinant human STK10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 369-519 aa of BC070077 Sequence: SQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKD Predict reactive species |
| Full Name | serine/threonine kinase 10 |
| Calculated Molecular Weight | 968 aa, 112 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC070077 |
| Gene Symbol | STK10 |
| Gene ID (NCBI) | 6793 |
| RRID | AB_2880096 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O94804 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lymphocyte-oriented kinase deficiency encoded by the serine/threonine kinase 10 (STK10) gene correlates with the intracellular adhesion molecule 1 (ICAM-1)/lymphocyte function associated antigen 1 (LFA-1) complex in aspirin hypersensitivity(PMID:21905501). STK 10 is also named as LOK and expressed as a 130-kDa protein, which was detected predominantly in lymphoid organs such as spleen, thymus, and bone marrow, in contrast to other mammalian members of the STE20 family(PMID:9278426).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for STK10 antibody 25471-1-AP | Download protocol |
| WB protocol for STK10 antibody 25471-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The STK10 Polyclonal antibody (Cat# 25471-1-AP) has 4 citations. These appear in Cell Mol Biol Lett, Clin Cancer Res, Front Immunol, and bioRxiv. The associated research fields span neurodegeneration (Huntington's disease phosphoproteomics), oncology (NF1-associated plexiform neurofibroma), immunology (immunogenic cell death via STK10 inhibition), and cell biology (ERK-mediated Rho activation and stress fiber assembly in cell migration).
| Species | Application | Title |
|---|---|---|
Cell Mol Biol Lett Phosphoproteomic profiling reveals post-translational dysregulation in Huntington's disease patient-derived neurons. | ||
Clin Cancer Res Combined CDK4/6 and ERK1/2 inhibition enhances anti-tumor activity in NF1-associated plexiform neurofibroma | ||
Front Immunol The enhancement of immunoactivity induced by immunogenic cell death through serine/threonine kinase 10 inhibition: a potential therapeutic strategy
| ||
bioRxiv Mechanism of ERK-mediated Rho Activation and Stress Fiber Assembly for Cell Migration.
|
Reviews
What customers say
The single review rates this antibody 5 stars for Western Blot at a 1:3000 dilution in 293T and H1299 cells. The reviewer describes it as highly potent and reusable, producing a strong specific band at approximately 140 kDa corresponding to LOK (STK10). Specificity was confirmed by CRISPR knockout, where the LOK band was absent in the knockout lane. A non-specific band near 200 kDa was noted but clearly distinguishable from the target. Overall, the antibody demonstrated excellent specificity, sensitivity, and consistency.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jared (Verified Customer) (08-21-2019) | This antibody is an all-star antibody. I can even re use it a couple of times, and it still works. potent stuff. Picture would not upload... There is one strong band, and it shows virtually nothing in the lane where I CRISPR'd out LOK aka STK10 in the LOK band area. There is a non-specific band, but that is located clearly out of the range of where the LOK band is located. Non-specific band at approx 200kd. LOK for me runs at around 140kd.
 |
