Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

STK10 Polyclonal antibody

STK10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25471-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

EC:2.7.11.1, LOK, Lymphocyte oriented kinase, Lymphocyte-oriented kinase, PRO2729

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, A549 cells, COLO 320 cells
Positive IHC detected inhuman lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25471-1-AP targets STK10 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22169

Product name: Recombinant human STK10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 369-519 aa of BC070077

Sequence: SQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKD

Predict reactive species
Full Name serine/threonine kinase 10
Calculated Molecular Weight 968 aa, 112 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC070077
Gene Symbol STK10
Gene ID (NCBI) 6793
RRIDAB_2880096
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94804
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lymphocyte-oriented kinase deficiency encoded by the serine/threonine kinase 10 (STK10) gene correlates with the intracellular adhesion molecule 1 (ICAM-1)/lymphocyte function associated antigen 1 (LFA-1) complex in aspirin hypersensitivity(PMID:21905501). STK 10 is also named as LOK and expressed as a 130-kDa protein, which was detected predominantly in lymphoid organs such as spleen, thymus, and bone marrow, in contrast to other mammalian members of the STE20 family(PMID:9278426).

Protocols

Product Specific Protocols
IHC protocol for STK10 antibody 25471-1-APDownload protocol
WB protocol for STK10 antibody 25471-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Front Immunol

The enhancement of immunoactivity induced by immunogenic cell death through serine/threonine kinase 10 inhibition: a potential therapeutic strategy

Authors - Xiaoli Xia
  • KD Validated
humanWB

bioRxiv

Mechanism of ERK-mediated Rho Activation and Stress Fiber Assembly for Cell Migration.

Authors - Akib M Khan
  • KO Validated

Clin Cancer Res

Combined CDK4/6 and ERK1/2 inhibition enhances anti-tumor activity in NF1-associated plexiform neurofibroma

Authors - Alyssa C Flint
humanWB

Cell Mol Biol Lett

Phosphoproteomic profiling reveals post-translational dysregulation in Huntington's disease patient-derived neurons.

Authors - Lea Danics

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jared (Verified Customer) (08-21-2019)

This antibody is an all-star antibody. I can even re use it a couple of times, and it still works. potent stuff. Picture would not upload... There is one strong band, and it shows virtually nothing in the lane where I CRISPR'd out LOK aka STK10 in the LOK band area. There is a non-specific band, but that is located clearly out of the range of where the LOK band is located. Non-specific band at approx 200kd. LOK for me runs at around 140kd.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: 293T and H1299
STK10 Antibody Western Blot, validation (1:3000 dilution) in 293T and H1299 (Cat no:25471-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...