Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, human testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10746-1-AP targets STK11/LKB1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1048 Product name: Recombinant human STK11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 134-433 aa of BC007981 Sequence: CGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ Predict reactive species |
| Full Name | serine/threonine kinase 11 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC007981 |
| Gene Symbol | LKB1 |
| Gene ID (NCBI) | 6794 |
| RRID | AB_2271311 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15831 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STK11(serine/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for STK11/LKB1 antibody 10746-1-AP | Download protocol |
| IP protocol for STK11/LKB1 antibody 10746-1-AP | Download protocol |
| WB protocol for STK11/LKB1 antibody 10746-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The STK11/LKB1 Polyclonal antibody (Cat# 10746-1-AP) has 82 citations across journals including Cell Metabolism, Nature Communications, EMBO Journal, Cell Reports, Nature Cell Biology, and Free Radical Biology and Medicine. Research fields span AMPK signaling, metabolic diseases (diabetes, NAFLD, obesity), cancer (lung, liver, breast, bladder), cardiovascular disease, autophagy, inflammation, lipid metabolism, and neuroprotection. Applications include WB, IHC, IF, IP, and CoIP across human, mouse, rat, and other species.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther VCPIP1 drives diabetic cardiomyopathy by deubiquitinating AMPKγ1 and preventing AMPKα-γ subunit assembly in cardiomyocytes. | ||
Cell Metab CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.
| ||
Cell Metab AMPKα2 signals amino acid insufficiency to inhibit protein synthesis.
| ||
Cell Metab Garlic-derived metabolite activates LKB1, promotes adipose eNAMPT secretion, and improves age-related muscle function via hypothalamic signaling. | ||
Nat Cell Biol AMPK-regulated glycerol excretion maintains metabolic crosstalk between reductive and energetic stress | ||
Kidney Int Rho-associated, coiled-coil-containing protein kinase 1 regulates development of diabetic kidney disease via modulation of fatty acid metabolism. |
Reviews
What customers say
The product received a single 5-star review. The reviewer used it for Western Blot at a 1:1000 dilution on nerve tissue and reported a highly positive experience, though no written comments were provided. Overall, the feedback indicates strong satisfaction with the antibody's performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bogdan (Verified Customer) (11-29-2018) |
|
