STK11/LKB1 Monoclonal antibody

STK11/LKB1 Monoclonal Antibody for WB, IF, IHC, ELISA
Cat No. 66719-1-Ig
Clone No.1H8E4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IF, IHC, ELISA

LKB1, PJS, serine/threonine kinase 11, STK11, STK11/ LKB1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HSC-T6 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells
Positive IHC detected inhuman testis tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66719-1-Ig targets STK11/LKB1 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13436

Product name: Recombinant human STK11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 134-433 aa of BC007981

Sequence: CGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ

Predict reactive species
Full Name serine/threonine kinase 11
Calculated Molecular Weight 49 kDa
Observed Molecular Weight 45-49 kDa
GenBank Accession NumberBC007981
Gene Symbol LKB1
Gene ID (NCBI) 6794
RRIDAB_2882070
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15831
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STK11(serine/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification.

Loading...
||
New chat

Able

正在加载,请稍候...