STK11/LKB1 Monoclonal antibody

• 

  WB analysis using 66719-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66719-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 66719-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 66719-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 66719-1-Ig

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66719-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66719-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66719-1-Ig (STK11/LKB1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66719-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using STK11/LKB1 antibody (66719-1-Ig, Clone: 1H8E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

STK11/LKB1 Monoclonal Antibody for WB, IF, IHC, ELISA

Cat No. 66719-1-Ig

Clone No.1H8E4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IF, IHC, ELISA

Synonyms

LKB1, PJS, serine/threonine kinase 11, STK11, STK11/ LKB1

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HSC-T6 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells
• Positive IHC detected in: human testis tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66719-1-Ig targets STK11/LKB1 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13436

  Product name: Recombinant human STK11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 134-433 aa of BC007981

  Sequence: CGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ

• Full Name: serine/threonine kinase 11
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 45-49 kDa
• GenBank Accession Number: BC007981
• Gene Symbol: LKB1
• Gene ID (NCBI): 6794
• RRID: AB_2882070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STK11(serine/threonine-protein kinase 11) is also named as LKB1, PJS, and belongs to the protein kinase superfamily. It controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. The tumour suppressor protein LKB1 is a serine/threonine kinase that has been causally linked to Peutz-Jeghers syndrome (PJS). Defects in STK11 are a cause of Peutz-Jeghers syndrome (PJS) and defects in STK11 have been associated with testicular germ cell tumor (TGCT) and some sporadic cancers, especially lung cancers. STK11 has 2 isoforms with MW of 49 kDa and 45 kDa, and can be detected as 50-54 kDa after posttranslational modification.