STK24 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STK24 Polyclonal antibody, PBS Only (29846-1-PBS)

• 

  WB analysis using 29846-1-AP (same clone as 29846-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29846-1-AP (STK24 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29846-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29846-1-AP (same clone as 29846-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29846-1-AP (STK24 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29846-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29846-1-AP (same clone as 29846-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29846-1-AP (STK24 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29846-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 29846-1-AP (same clone as 29846-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29846-1-AP (STK24 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29846-1-PBS in a different storage buffer formulation.

STK24 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29846-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29846-1-PBS targets STK24 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31519

  Product name: Recombinant human STK24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 320-443 aa of NM_003576

  Sequence: SDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH

• Full Name: serine/threonine kinase 24 (STE20 homolog, yeast)
• Calculated Molecular Weight: 49KD
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_003576
• Gene Symbol: STK24
• Gene ID (NCBI): 8428
• RRID: AB_2923614
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6E0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Serine/threonine-protein kinase 24 (STK24), also named MST3, belonging to GCK subfamily of STE20-like kinases, acts on both serine and threonine residues and promotes apoptosis in response to stress stimuli and caspase activation (PubMed: 10644707, PMID:12107159). STK24 and STK25 operate in the same cardiovascular development pathway with programmed cell death 10 (CCM3) (PMID: 20332113). It regulates axon outgrowth in forebrain neurons (PubMed: 17114295).