STK31 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STK31 Polyclonal antibody, PBS Only (14140-1-PBS)

• 

  WB analysis of mouse testis using 14140-1-AP (same clone as 14140-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14140-1-AP (STK31 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat testis using 14140-1-AP (same clone as 14140-1-PBS)

  rat testis tissue were subjected to SDS PAGE followed by western blot with 14140-1-AP (STK31 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 14140-1-AP (same clone as 14140-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14140-1-AP (STK31 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 14140-1-AP (same clone as 14140-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 14140-1-AP (STK31 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14140-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 14140-1-AP (same clone as 14140-1-PBS)

  IP result of anti-STK31 (IP:14140-1-AP, 4ug; Detection:14140-1-AP 1:1000) with mouse testis tissue lysate 2400ug. This data was developed using the same antibody clone with 14140-1-PBS in a different storage buffer formulation.

STK31 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 14140-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

14140-1-PBS targets STK31 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5221

  Product name: Recombinant human STK31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 714-1019 aa of BC059374

  Sequence: KYMNSGGLLTMSLERDLLDAEPMKELSSKRPLVRSEVNGQIILLKGYSVDVDTEAKVIERAATYHRAWREAEGDSGLLPLIFLFLCKSDPMAYLMVPYYPRANLNAVQANMPLNSEETLKVMKGVAQGLHTLHKADIIHGSLHQNNVFALNREQGIVGDFDFTKSVSQRASVNMMVGDLSLMSPELKMGKPASPGSDLYAYGCLLLWLSVQNQEFEINKDGIPKVDQFHLDDKVKSLLCSLICYRSSMTAEQVLNAECFLMPKEQSVPNPEKDTEYTLYKKEEEIKTENLDKCMEKTRNGEANFDC

• Full Name: serine/threonine kinase 31
• Calculated Molecular Weight: 1019 aa, 116 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC059374
• Gene Symbol: STK31
• Gene ID (NCBI): 56164
• RRID: AB_2878021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXU1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.