STK38L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STK38L Polyclonal antibody, PBS Only (12697-1-PBS)

• 

  WB analysis using 12697-1-AP (same clone as 12697-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12697-1-AP (STK38L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 12697-1-AP (same clone as 12697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12697-1-AP (STK38L Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 12697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 12697-1-AP (same clone as 12697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12697-1-AP (STK38L Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12697-1-PBS in a different storage buffer formulation.

STK38L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12697-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12697-1-PBS targets STK38L in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3413

  Product name: Recombinant human STK38L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-376 aa of BC028603

  Sequence: FESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEE

• Full Name: serine/threonine kinase 38 like
• Calculated Molecular Weight: 464 aa, 54 kDa
• Observed Molecular Weight: 43-54 kDa
• GenBank Accession Number: BC028603
• Gene Symbol: STK38L
• Gene ID (NCBI): 23012
• RRID: AB_2240003
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2H1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STK38L, also named as KIAA0965 and NDR2, belongs to the protein kinase superfamily and AGC Ser/Thr protein kinase family. It is involved in the regulation of structural processes in differentiating and mature neuronal cells. This antibody is specific to STK38L.