STK39 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83081-2-RR (same clone as 83081-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83081-2-RR (STK39 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83081-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 83081-2-RR (same clone as 83081-2-PBS)

  WB result of STK39 antibody (83081-2-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STK39 transfected HepG2 cells. This data was developed using the same antibody clone with 83081-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP00106-3

  The mean STK39 concentration was determined to be 2,623.5 pg/mL in HepG2 cell extract based on a 4.2 mg/mL extract load and 9,245.2 pg/mL in Jurkat cell extract based on a 4.6 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP00106-3

  Sandwich ELISA standard curve of MP00106-3, Human STK39 Recombinant Matched Antibody Pair - PBS only. 83081-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag34503. 83081-1-PBS was HRP conjugated as the detection antibody. Range: 31.3-2000 pg/mL.

• 

  IF Staining of mouse brain using 83081-2-RR (same clone as 83081-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using STK39 antibody (83081-2-RR, Clone: 230382G9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83081-2-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 83081-2-RR (same clone as 83081-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using STK39 antibody (83081-2-RR, Clone: 230382G9 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83081-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83081-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83081-2-RR against Human STK39 were performed. The affinity constant is 2.52 nM.

• Featured Product
• KD/KO Validated

STK39 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA

Cat No. 83081-2-PBS

Clone No.230382G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA

Synonyms

230382G9, DCHT, PASK, SPAK, Ste 20 related kinase

---

Product Information

83081-2-PBS targets STK39 as part of a matched antibody pair:

MP00106-3: 83081-2-PBS capture and 83081-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34503

  Product name: Recombinant human STK39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-455 aa of BC166614

  Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV

• Full Name: serine threonine kinase 39 (STE20/SPS1 homolog, yeast)
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC166614
• Gene Symbol: STK39
• Gene ID (NCBI): 27347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UEW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).