• Featured Product
  • KD/KO Validated

STK39 Recombinant monoclonal antibody, PBS Only (Capture)

STK39 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA
Cat No. 83081-2-PBS
Clone No.230382G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA

230382G9, DCHT, PASK, SPAK, Ste 20 related kinase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83081-2-PBS targets STK39 as part of a matched antibody pair:

MP00106-3: 83081-2-PBS capture and 83081-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34503

Product name: Recombinant human STK39 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 396-455 aa of BC166614

Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV

Predict reactive species
Full Name serine threonine kinase 39 (STE20/SPS1 homolog, yeast)
Calculated Molecular Weight59 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberBC166614
Gene Symbol STK39
Gene ID (NCBI) 27347
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UEW8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).

Loading...
||
New chat Able
正在加载,请稍候...