STK39 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 83081-3-RR (same clone as 83081-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83081-3-RR (STK39 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83081-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83081-3-RR (same clone as 83081-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using STK39 antibody (83081-3-RR, Clone: 230382G12 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 83081-3-PBS in a different storage buffer formulation.

• 

  FC experiment of Daudi using 83081-3-RR (same clone as 83081-3-PBS)

  1x10^6 Daudi cells were intracellularly stained with 0.25 ug Anti-Human STK39 (83081-3-RR, Clone:230382G12) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83081-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83081-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83081-3-RR against Human STK39 were performed. The affinity constant is 1.21 nM.

STK39 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83081-3-PBS

Clone No.230382G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

230382G12, DCHT, PASK, SPAK, Ste 20 related kinase

---

Product Information

83081-3-PBS targets STK39 in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34503

  Product name: Recombinant human STK39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 396-455 aa of BC166614

  Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV

• Full Name: serine threonine kinase 39 (STE20/SPS1 homolog, yeast)
• Calculated Molecular Weight: 59 kDa
• GenBank Accession Number: BC166614
• Gene Symbol: STK39
• Gene ID (NCBI): 27347
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UEW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).