STOML1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STOML1 Polyclonal antibody, PBS Only (12862-1-PBS)

• 

  WB analysis of A375 using 12862-1-AP (same clone as 12862-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 12862-1-AP (STOML1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12862-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12862-1-AP (same clone as 12862-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12862-1-AP (STOML1 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12862-1-AP (same clone as 12862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12862-1-AP (STOML1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12862-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12862-1-AP (same clone as 12862-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12862-1-AP (STOML1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12862-1-PBS in a different storage buffer formulation.

STOML1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12862-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12862-1-PBS targets STOML1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3978

  Product name: Recombinant human STOML1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 79-398 aa of BC034379

  Sequence: LKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQPFLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDVVVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK

• Full Name: stomatin (EPB72)-like 1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC034379
• Gene Symbol: STOML1
• Gene ID (NCBI): 9399
• RRID: AB_2197415
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBI4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.