• Featured Product
  • KD/KO Validated

STS Polyclonal antibody

STS Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 17870-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

ARSC, ARSC1, Arylsulfatase C, ASC, ES, SSDD, Steroid sulfatase, Steryl sulfatase, Steryl sulfate sulfohydrolase, STS

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF7 cells, human placenta tissue
Positive IHC detected inhuman placenta tissue, human hysteromyoma tissue, human kidney tissue, human lung tissue, human ovary tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17870-1-AP targets STS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12353

Product name: Recombinant human STS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 236-583 aa of BC075030

Sequence: YFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCFGSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR

Predict reactive species
Full Name steroid sulfatase (microsomal), isozyme S
Calculated Molecular Weight 583 aa, 65 kDa
Observed Molecular Weight 63-65 kDa
GenBank Accession NumberBC075030
Gene Symbol STS
Gene ID (NCBI) 412
RRIDAB_2240080
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08842
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STS(Steroid sulfatase) is also named as ASC(arylsulfatase C), ARSC1 and belongs to the sulfatase family. It is expressed in human liver and is responsible for the hydrolysis of many estrogen and hydroxysteroid sulfates, including dehydroepiandrosterone (DHEA)-sulfate and β-estradiol(E2)-3-sulfate(PMID:19589875). This enzyme has also been documented to occur in many other tissues, including skin, lung, ovary, and adrenal gland. The estimated molecular mass of expressed human STS is 63-85 kDa which may represent different levels of glycosylation in the different tissues, as STS is known to be a glycoprotein and the full length protein has a signal peptide with 21 amino acids(PMID:17604157).

Protocols

Product Specific Protocols
WB protocol for STS antibody 17870-1-APDownload protocol
IHC protocol for STS antibody 17870-1-APDownload protocol
IF protocol for STS antibody 17870-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Clin Cancer Res

Steroid Sulfatase Stimulates Intracrine Androgen Synthesis and is a Therapeutic Target for Advanced Prostate Cancer.

Authors - Cameron M Armstrong
  • KD Validated
mouse, ratWB

Sci Rep

Estrogen Secreted by Mesenchymal Stem Cells Necessarily Determines Their Feasibility of Therapeutical Application.

Authors - Jiansha Li
humanWB

Mol Cell Biochem

Resveratrol and its methoxy derivatives modulate the expression of estrogen metabolism enzymes in breast epithelial cells by AhR down-regulation.

Authors - Barbara Licznerska
mouseWB,IF

J Biomed Res

Suppressed estrogen supply via extra-ovarian progesterone receptor membrane component 1 in menopause.

Authors - Sang R Lee
mouseIF

Life Sci Alliance

Macrophage Sult2b1 promotes pathological neovascularization in age-related macular degeneration

Authors - Yafang Wang
Loading...
||
New chat Able
正在加载,请稍候...