STT3A Recombinant monoclonal antibody

STT3A Uni-rAb® Recombinant Antibody for ELISA
Cat No. 83077-4-RR
Clone No.230426B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

ITM1, Integral membrane protein 1, EC:2.4.99.18, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A, B5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83077-4-RR targets STT3A in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31994

Product name: Recombinant human STT3A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 550-600 aa of BC020965

Sequence: THISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV

Predict reactive species
Full Name STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae)
Calculated Molecular Weight 705 aa, 81 kDa
GenBank Accession NumberBC020965
Gene Symbol STT3A
Gene ID (NCBI) 3703
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP46977
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STT3A, also named as Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A, is a 705 amino acid prtein, which belongs to the STT3 family. STT3A is expressed at high levels in placenta, liver, muscle and pancreas, and at very low levels in brain, lung and kidney. STT3A is a catalytic subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity. STT3A is present in the majority of OST complexes and mediates cotranslational N-glycosylation of most sites on target proteins, while STT3B-containing complexes are required for efficient post-translational glycosylation and mediate glycosylation of sites that have been skipped by STT3A.

Loading...
||
New chat Able
正在加载,请稍候...