Syntaxin 1A / Syntaxin 1B Polyclonal antibody

• 

Syntaxin 1A / Syntaxin 1B Polyclonal Antibody for ELISA

Cat No. 16798-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

STX1B, STX1B1, STX1B2, syntaxin 1B, Syntaxin 1B1, Syntaxin 1B2

---

Product Information

16798-1-AP targets Syntaxin 1A / Syntaxin 1B in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10275

  Product name: Recombinant human STX1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-263 aa of BC062298

  Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK

• Full Name: syntaxin 1B
• Calculated Molecular Weight: 288 aa, 33 kDa
• GenBank Accession Number: BC062298
• Gene Symbol: STX1B
• Gene ID (NCBI): 112755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61266
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.