Syntaxin 8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Syntaxin 8 Polyclonal antibody (12206-1-AP)

• 

  WB analysis using 12206-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12206-1-AP (Syntaxin 8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A375 using 12206-1-AP

  IP result of anti-Syntaxin 8 (IP:12206-1-AP, 4ug; Detection:12206-1-AP 1:500) with A375 cells lysate 3600ug.

• 

  IF Staining of HepG2 using 12206-1-AP

  Immunofluorescent analysis of HepG2 cells, using STX8 antibody 12206-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• Featured Product
• KD/KO Validated

Syntaxin 8 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 12206-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

STX8, Syntaxin-8

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: A375 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• CoIP: See 1 publications below

Product Information

12206-1-AP targets Syntaxin 8 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2850

  Product name: Recombinant human STX8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC009713

  Sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKS

• Full Name: syntaxin 8
• Calculated Molecular Weight: 236 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC009713
• Gene Symbol: Syntaxin 8
• Gene ID (NCBI): 9482
• RRID: AB_2196671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNK0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntaxin 8 (STX8), also known as CIP-1-associated regulator of cyclin B (CARB ), is a protein belonging to the syntaxin family. The gene of STX8 maps to chromosomal band 17p12 and it encodes a 236-amino-acid protein containing 1 t-SNARE coiled-coil homology domain. STX8 mRNA is broadly expressed in multiple human tissues, including the heart, brain, kidney, liver, lung, placenta, skeletal muscle, spleen, and pancreas (PMID: 10198254). STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,CoIP	J Cell Biol; VAMP4 regulates insulin levels by targeting secretory granules to lysosomes; Authors - Min Li ; KD Validated
mouse		PLoS One; The Gag protein PEG10 binds to RNA and regulates trophoblast stem cell lineage specification.; Authors - Mona Abed