Syntaxin 8 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86580-1-RR (same clone as 86580-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86580-1-RR (STX8 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86580-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02538-1

  The mean Syntaxin 8 concentration was determined to be 28.1 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 43.4 ng/mL in A375 cell extract based on a 1.6 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02538-1

  Cytometric bead array standard curve of MP02538-1, Syntaxin 8 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86580-2-PBS. Detection antibody: 86580-1-PBS. Standard: Ag2850. Range: 0.469-60 ng/mL.

• 

  Affinity and Kinetic Characterization of 86580-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86580-1-RR against Human Syntaxin 8 were performed. The affinity constant is 0.454 nM.

Syntaxin 8 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 86580-1-PBS

Clone No.251516G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

STX8, Syntaxin-8

---

Product Information

86580-1-PBS targets Syntaxin 8 as part of a matched antibody pair:

MP02538-1: 86580-2-PBS capture and 86580-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2850

  Product name: Recombinant human STX8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-211 aa of BC009713

  Sequence: MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKS

• Full Name: syntaxin 8
• Calculated Molecular Weight: 236 aa, 27 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC009713
• Gene Symbol: Syntaxin 8
• Gene ID (NCBI): 9482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UNK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Syntaxin 8 (STX8), also known as CIP-1-associated regulator of cyclin B (CARB ), is a protein belonging to the syntaxin family. The gene of STX8 maps to chromosomal band 17p12 and it encodes a 236-amino-acid protein containing 1 t-SNARE coiled-coil homology domain. STX8 mRNA is broadly expressed in multiple human tissues, including the heart, brain, kidney, liver, lung, placenta, skeletal muscle, spleen, and pancreas (PMID: 10198254). STX8 is involved in protein trafficking from early to late endosomes via vesicle fusion and exocytosis.