SUCLA2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68549-1-Ig (same clone as 68549-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68549-1-Ig (SUCLA2 antibody) at dilution of 1:9900 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68549-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68549-1-Ig (same clone as 68549-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68549-1-Ig (SUCLA2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68549-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 68549-1-Ig (same clone as 68549-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68549-1-Ig (SUCLA2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68549-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Caco-2 using 68549-1-Ig (same clone as 68549-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Caco-2 cells using SUCLA2 antibody (68549-1-Ig, Clone: 2C7E4 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 68549-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68549-1-Ig (same clone as 68549-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SUCLA2 antibody (68549-1-Ig, Clone: 2C7E4 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red). This data was developed using the same antibody clone with 68549-1-PBS in a different storage buffer formulation.

SUCLA2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68549-1-PBS

Clone No.2C7E4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

SCS betaA, EC:6.2.1.5, ATP-specific succinyl-CoA synthetase subunit beta, A-SCS, A BETA

---

Product Information

68549-1-PBS targets SUCLA2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17967

  Product name: Recombinant human SUCLA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-353 aa of BC027587

  Sequence: AQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERDKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGAT

• Full Name: succinate-CoA ligase, ADP-forming, beta subunit
• Calculated Molecular Weight: 463 aa, 50 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC027587
• Gene Symbol: SUCLA2
• Gene ID (NCBI): 8803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P2R7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SUCLA2, β subunit of succinate-CoA ligase, contributes to energy production in mitochondria through the succinate-CoA ligase enzyme. Succinate-CoA ligase catalyses the reversible conversion of succinyl-CoA and ADP or GDP to succinate and ATP or GTP. SUCLA2 mutations cause global protein succinylation and mitochondrial DNA depletion (PMID: 33230181, PMID: 20301762). Mutations in SUCLA2 are also associated with SUCLA2-related mitochondrial DNA depletion syndrome, leigh syndrome, down syndrome (PMID: 23010432).