SUCO Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SUCO Polyclonal antibody, PBS Only (26074-1-PBS)

• 

  IHC staining of human brain using 26074-1-AP (same clone as 26074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26074-1-AP (SUCO Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 26074-1-AP (same clone as 26074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26074-1-AP (C1orf9 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 26074-1-AP (same clone as 26074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26074-1-AP (C1orf9 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 26074-1-AP (same clone as 26074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26074-1-AP (C1orf9 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26074-1-PBS in a different storage buffer formulation.

SUCO Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26074-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

26074-1-PBS targets SUCO in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23224

  Product name: Recombinant human C1orf9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 902-1254 aa of BC137125

  Sequence: GNLVHGSNQKESVFMRLNNRIKALEVNMSLSGRYLEELSQRYRKQMEEMQKAFNKTIVKLQNTSRIAEEQDQRQTEAIQLLQAQLTNMTQLVSNLSATVAELKREVSDRQSYLVISLVLCVVLGLMLCMQRCRNTSQFDGDYISKLPKSNQYPSPKRCFSSYDDMNLKRRTSFPLMRSKSLQLTGKEVDPNDLYIVEPLKFSPEKKKKRCKYKIEKIETIKPEEPLHPIANGDIKGRKPFTNQRDFSNMGEVYHSSYKGPPSEGSSETSSQSEESYFCGISACTSLCNGQSQKTKTEKRALKRRRSKVQDQGKLIKTLIQTKSGSLPSLHDIIKGNKEITVGTFGVTAVSGHI

• Full Name: chromosome 1 open reading frame 9
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC137125
• Gene Symbol: SUCO
• Gene ID (NCBI): 51430
• RRID: AB_2880363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBS9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.