SULF2 Polyclonal antibody

• 

  WB analysis using 29591-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29591-1-AP (SULF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SULF2 Polyclonal Antibody for WB, ELISA

Cat No. 29591-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

DKFZp313E091, Extracellular sulfatase Sulf 2, FLJ90554, HSULF 2, KIAA1247, SULF2, sulfatase 2

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29591-1-AP targets SULF2 in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31106

  Product name: Recombinant human SULF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 481-720 aa of BC110539

  Sequence: MRLGGSRALSNLVPKYYGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPRNLTKRHWPGAPEDQDDKDGGDFSGTGGLPDYSAANPIKVTHRCYILENDTVQCDLDLYKSLQAWKDHKLHIDHEIETLQNKIKNLREVRGHLKKKRPEECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEKDKVWLLREQKRKKKLRKLLKRLQNNDTC

• Full Name: sulfatase 2
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC110539
• Gene Symbol: SULF2
• Gene ID (NCBI): 55959
• RRID: AB_3086143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. SULF2 can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin (PMID:12368295, PMID:30788513, PMID:35294879).