SULT1A4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SULT1A4 Polyclonal antibody (11376-1-AP)

SULT1A4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11376-1-AP Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Aryl sulfotransferase 1A3/1A4, Catecholamine-sulfating phenol sulfotransferase, EC:2.8.2.1, HAST3, M PST

• 

  WB analysis of human colon using 11376-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 11376-1-AP (SULT1A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11376-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11376-1-AP (SULT1A4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human pancreas using 11376-1-AP

  human pancreas tissue were subjected to SDS PAGE followed by western blot with 11376-1-AP (SULT1A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 11376-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11376-1-AP (SULT1A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 11376-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11376-1-AP (SULT1A4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BxPC-3 using 11376-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 11376-1-AP (SULT1A4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11376-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11376-1-AP (SULT1A4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11376-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11376-1-AP (SULT1A4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11376-1-AP

  Immunofluorescent analysis of HepG2 cells using 11376-1-AP (SULT1A4 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11376-1-AP

  Immunofluorescent analysis of HepG2 cells, using SULT1A4 antibody 11376-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SULT1A4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, human colon tissue, human pancreas tissue, HepG2 cells, mouse pancreas tissue, Caco-2 cells, HT-29 cells, HuH-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11376-1-AP targets SULT1A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1935

  Product name: Recombinant human SULT1A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC014471

  Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

• Full Name: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4
• Calculated Molecular Weight: 295 aa, 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC014471
• Gene Symbol: SULT1A4
• Gene ID (NCBI): 445329
• RRID: AB_2197610
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DMN0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SULT1A4 (sulfotransferase family 1A member 4) is a cytosolic phase II metabolizing enzyme encoded by a duplicated gene on human chromosome 16. It shares identical protein sequence with SULT1A3, using PAPS as sulfate donor to catalyze sulfation of catecholamines, serotonin, thyroid hormones and phenolic drugs. This modification increases substrate solubility for excretion. SULT1A4 genetic variants alter drug metabolism; its polymorphisms are linked to variable responses to adrenergic agents and analgesics. (PMID: 29705271)