SULT2B1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SULT2B1 Polyclonal antibody, PBS Only (29185-1-PBS)

• 

  WB analysis using 29185-1-AP (same clone as 29185-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29185-1-AP (SULT2B1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29185-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 29185-1-AP (same clone as 29185-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 29185-1-AP (SULT2B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29185-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 29185-1-AP (same clone as 29185-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using SULT2B1 antibody (29185-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 29185-1-PBS in a different storage buffer formulation.

SULT2B1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 29185-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29185-1-PBS targets SULT2B1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30209

  Product name: Recombinant human SULT2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 283-365 aa of BC034694

  Sequence: NHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS

• Full Name: sulfotransferase family, cytosolic, 2B, member 1
• Calculated Molecular Weight: 365 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC034694
• Gene Symbol: SULT2B1
• Gene ID (NCBI): 6820
• RRID: AB_2918245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00204
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SULT2B1 is a member of hydroxysteroid sulfotransferase (SULT) family that catalyzes sulfonation of hormones and other molecules. SULT2B1 encodes two isoforms, SULT2B1a and SULT2B1b, that differ only at their amino termini but have distinct biochemical properties as well as tissue distribution. The human fetal brain appears to only express the SULT2B1a isoform, while SULT2B1b is the predominant hydroxysteroid sulfotransferase expressed in human skin. Northern blot analysis revealed SULT2B1a has a limited tissue distribution in liver, adrenal and stomach, whereas SULT2B1b can be detected in a variety of hormone-responsive tissues including placenta, ovary, uterus, and prostate.