SUMF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SUMF1 Polyclonal antibody (25015-1-AP)

SUMF1 Polyclonal Antibody for WB, ELISA

Cat No. 25015-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

AAPA3037, FGE, sulfatase modifying factor 1, SUMF1, UNQ3037/PRO9852

• 

  WB analysis of mouse liver using 25015-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 25015-1-AP (SUMF1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SUMF1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25015-1-AP targets SUMF1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19998

  Product name: Recombinant human SUMF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 34-374 aa of BC121122

  Sequence: SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD

• Full Name: sulfatase modifying factor 1
• Calculated Molecular Weight: 374 aa, 41 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC121122
• Gene Symbol: SUMF1
• Gene ID (NCBI): 285362
• RRID: AB_2879847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBK3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Antibody 25015-1-AP (anti-SUMF1) has 1 total citation. It appears in Aging (Albany NY), a study investigating SUMF1 overexpression in glioma, focusing on tumorous cell growth, migration, and its correlation with patient immune status. The research field encompasses neuro-oncology and tumor immunology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Aging (Albany NY); SUMF1 overexpression promotes tumorous cell growth and migration and is correlated with the immune status of patients with glioma; Authors - Ping Zhang