SUMO tag Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SUMO tag Polyclonal antibody (27205-1-AP)

SUMO tag Polyclonal Antibody for WB, ELISA

Cat No. 27205-1-AP Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

recombinant protein

Applications

WB, ELISA

Synonyms

• 

  WB analysis using 27205-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27205-1-AP (SUMO tag antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SUMO tag in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27205-1-AP targets SUMO tag in WB, ELISA applications and shows reactivity with recombinant protein samples.

• Tested Reactivity: recombinant protein
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26104

  Product name: Recombinant SUMO tag protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of

  Sequence: msdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedldmedndiieahreqiggs

• Full Name: SUMO tag
• RRID: AB_3742219
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SUMO tag (Small Ubiquitin-like Modifier) is a small protein approximately 100 amino acids in length (about 11 kDa). It is a member of the ubiquitin-like protein family and shares structural similarity with ubiquitin but has distinct functions. In the field of recombinant protein expression, the SUMO tag has been developed into a useful tool for enhancing protein solubility and expression levels. The SUMO tag is a highly efficient fusion tag with numerous advantages. It plays a significant role in recombinant protein expression, purification, and functional studies. Its applications continue to expand, contributing to advancements in life science research and biotechnology development.