SUPT4H1 Polyclonal antibody

• 

SUPT4H1 Polyclonal Antibody for ELISA

Cat No. 15411-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

DSIF p14, DSIF small subunit, hSPT4, SPT4, SPT4H, SUPT4H, SUPT4H1

---

Product Information

15411-1-AP targets SUPT4H1 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7678

  Product name: Recombinant human SUPT4H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-117 aa of BC002802

  Sequence: MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

• Full Name: suppressor of Ty 4 homolog 1 (S. cerevisiae)
• Calculated Molecular Weight: 13 kDa
• GenBank Accession Number: BC002802
• Gene Symbol: SUPT4H1
• Gene ID (NCBI): 6827
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63272
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.