SUV39H2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SUV39H2 Polyclonal antibody (11338-1-AP)

• Featured Product
• KD/KO Validated

SUV39H2 Polyclonal Antibody for WB, ELISA

Cat No. 11338-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

H3 K9 HMTase 2, KMT1B, Lysine N methyltransferase 1B, Su(var)3 9 homolog 2, SUV39H2

• 

  WB analysis of HEK-293 using 11338-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11338-1-AP (SUV39H2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SUV39H2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11338-1-AP targets SUV39H2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1882

  Product name: Recombinant human SUV39H2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-350 aa of BC007754

  Sequence: VKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

• Full Name: suppressor of variegation 3-9 homolog 2 (Drosophila)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC007754
• Gene Symbol: SUV39H2
• Gene ID (NCBI): 79723
• RRID: AB_2196730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5I1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Anti-SUV39H2 antibody (Cat# 11338-1-AP) has 17 citations across journals including Cell Metabolism, Nature Communications, Hepatology, Molecular Cell, Nucleic Acids Research, Advanced Science, Cell Death & Differentiation, JBC, Frontiers in Oncology, Epigenomics, Sci Advances, and others. Research fields span epigenetics and heterochromatin biology, histone modification, cancer (breast, glioblastoma, nasopharyngeal), lipid metabolism/NAFLD, stem cell biology, autophagy, and spermatogenesis.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB,IP	Cell Metab; Pregnenolone promotes immune evasion through blocking endogenous retrovirus expression.; Authors - Changsheng Huang
mouse	WB	Nat Commun; Improving erectile function in diabetic male mice by rescuing depalmitoylated FBP1 to reduce cavernosal lactate.; Authors - Ming Xiao
mouse	WB	Hepatology; The histone methyltransferase Suv39h2 contributes to nonalcoholic steatohepatitis in mice.; Authors - Zhiwen Fan ; KO Validated
mouse	WB	Mol Cell; Requirements for establishment and epigenetic stability of mammalian heterochromatin; Authors - Antonis Tatarakis ; KD Validated
mouse	WB	Nucleic Acids Res; The ZBTB24-CDCA7-HELLS axis suppresses the totipotent 2C-like reprogramming by maintaining Dux methylation and repression; Authors - Dan Guo
human	WB	Nucleic Acids Res; Alternative splicing regulates the expression of G9A and SUV39H2 methyltransferases, and dramatically changes SUV39H2 functions.; Authors - Oriane Mauger