SV2B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SV2B Polyclonal antibody (14624-1-AP)

SV2B Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 14624-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

HsT19680, KIAA0735, SV2B

• 

  WB analysis of human brain using 14624-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14624-1-AP (SV2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14624-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14624-1-AP (SV2B antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14624-1-AP

  IP result of anti-SV2B (IP:14624-1-AP, 4ug; Detection:14624-1-AP 1:500) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 14624-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14624-1-AP (SV2B antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 14624-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 14624-1-AP (SV2B antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SV2B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14624-1-AP targets SV2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6137

  Product name: Recombinant human SV2B protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-353 aa of BC030011

  Sequence: MDDYKYQDNYGGYAPSDGYYRGNESNPEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDVKAKQAKMAPSRMDSLRGQTDLMAERLEDEEQLAHQYETIMDECGHGRFQWILFFVLGLALMADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPCTVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPKQMDEFIEIQ

• Full Name: synaptic vesicle glycoprotein 2B
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 77 kDa
• GenBank Accession Number: BC030011
• Gene Symbol: SV2B
• Gene ID (NCBI): 9899
• RRID: AB_10641040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L1I2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SV2B polyclonal antibody (Cat# 14624-1-AP) has 6 citations published in Advanced Science, Neuroscience Bulletin, Scientific Reports, Frontiers in Neurology, and Brain Research. The associated research fields include renal cell carcinoma, neurodegeneration (Huntington's disease), brain tumors (medulloblastoma and glioblastoma), striatal synaptic function, and vascular dementia.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Adv Sci (Weinh); SV2B Promotes the Progression of TFE3-Rearranged Renal Cell Carcinoma by Interacting with HERC2 to Impede the Degradation of NF-κB Subunits.; Authors - Huayi Feng
mouse	WB	Neurosci Bull; Mutant Huntingtin Causes a Selective Decrease in the Expression of Synaptic Vesicle Protein 2C.; Authors - Chaohua Peng
human	IHC,IF	Sci Rep; SV2B/miR-34a/miR-128 axis as prognostic biomarker in glioblastoma multiforme; Authors - D Mustafov
human	WB,IF	Sci Rep; New microRNA-based therapies reveal common targets in paediatric medulloblastoma and adult glioblastoma.; Authors - Denis Mustafov
mouse	WB	Front Neurol; Environmental Enrichment Upregulates Striatal Synaptic Vesicle-Associated Proteins and Improves Motor Function.; Authors - Suk-Young Song
		Brain Res; Aberrant signals in vascular dementia: Pleiotrophin/laminin pathway and glutamate metabolic dysregulation.; Authors - Xingfang Zhang