SYCP3 Polyclonal antibody

SYCP3 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 30079-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

SCP3, COR1, SCP 3, SCP-3, Synaptonemal complex protein 3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, rat testis tissue
Positive IHC detected inmouse testis tissue, human placenta tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

30079-1-AP targets SYCP3 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32466

Product name: Recombinant human SYCP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 137-236 aa of BC062662

Sequence: DLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF

Predict reactive species
Full Name synaptonemal complex protein 3
Calculated Molecular Weight 236 aa, 28 kDa
Observed Molecular Weight 27 kDa, 28 kDa
GenBank Accession NumberBC062662
Gene Symbol SYCP3
Gene ID (NCBI) 50511
RRIDAB_2935511
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IZU3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SYCP3 is an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. SYCP3 is required for centromere pairing during meiosis in male germ cells. SYCP3 is also required for normal meiosis during spermatogenesis and male fertility. Mutations in SYCP3 are associated with azoospermia in males and susceptibility to pregnancy loss in females.

Protocols

Product Specific Protocols
WB protocol for SYCP3 antibody 30079-1-APDownload protocol
IHC protocol for SYCP3 antibody 30079-1-APDownload protocol
FC protocol for SYCP3 antibody 30079-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Elife

Absence of CEP78 causes photoreceptor and sperm flagella impairments in mice and a human individual

Authors - Tianyu Zhu
Loading...
||
New chat Able
正在加载,请稍候...