SYF2 Polyclonal antibody

• 

  WB analysis of HEK-293 using 16958-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16958-1-AP (SYF2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 16958-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16958-1-AP (SYF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 16958-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 16958-1-AP (SYF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SYF2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16958-1-AP

Publications(1)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, RIP, ELISA

Synonyms

Pre-mRNA-splicing factor SYF2, Pre mRNA splicing factor SYF2, GCIPIP, CCNDBP1-interactor, CCNDBP1 interactor

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• RIP: See 1 publications below

Product Information

16958-1-AP targets SYF2 in WB, IF/ICC, RIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10656

  Product name: Recombinant human SYF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-243 aa of BC010862

  Sequence: MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV

• Full Name: SYF2 homolog, RNA splicing factor (S. cerevisiae)
• Calculated Molecular Weight: 243 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC010862
• Gene Symbol: SYF2
• Gene ID (NCBI): 25949
• RRID: AB_2197205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95926
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,RIP	Nucleic Acids Res; ZRANB2 and SYF2-mediated splicing programs converging on ECT2 are involved in breast cancer cell resistance to doxorubicin.; Authors - Iris Tanaka ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Moritz (Verified Customer) (09-24-2025)

Worked well for Syf2 detection in HEK293T cells

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: HEK293T

SYF2 Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:16958-1-AP)

FH

Aleksandr (Verified Customer) (07-19-2025)

A major band on Syf2 is detected. Antibody was incubated overnight at 4C

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: RKO

SYF2 Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:16958-1-AP)

FH

Tsimafei (Verified Customer) (08-07-2024)

Antibody recognize a strong band of the correct size. Also two lower nolecular weight non-specific bands are visible

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000
• Cell Tissue Type: mESCs

SYF2 Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:16958-1-AP)