Syncoilin Polyclonal antibody

• 

  WB analysis using 25151-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25151-1-AP (Syncoilin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 25151-1-AP

  IP result of anti-Syncoilin (IP:25151-1-AP, 4ug; Detection:25151-1-AP 1:800) with mouse heart tissue lysate 4000ug.

• 

  IHC staining of human skeletal muscle using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25151-1-AP (SYNC Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 25151-1-AP (SYNC Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse heart using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25151-1-AP (Syncoilin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25151-1-AP (Syncoilin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25151-1-AP (Syncoilin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 25151-1-AP (Syncoilin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 25151-1-AP (SYNC Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 25151-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 25151-1-AP (SYNC Antibody) at dilution of 1:50 (under 40x lens).

Syncoilin Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25151-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

SYNC, Syncoilin-1, Syncoilin 1, SYNC1

---

Tested Applications

• Positive WB detected in: mouse heart tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: mouse heart tissue, human heart tissue, mouse skeletal muscle tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

25151-1-AP targets Syncoilin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18565

  Product name: Recombinant human SYNC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 332-482 aa of BC119700

  Sequence: MAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV

• Full Name: syncoilin, intermediate filament protein
• Calculated Molecular Weight: 482 aa, 55 kDa
• Observed Molecular Weight: 64-68 kDa, 55 kDa
• GenBank Accession Number: BC119700
• Gene Symbol: SYNC
• Gene ID (NCBI): 81493
• RRID: AB_2879926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7C4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syncoilin also known as SYNC1, is a member of the intermediate filament family with an N-terminal head domain, followed by a central coiled-coil region and a short C-terminal tail. Syncoilin is highly expressed in skeletal and cardiac muscle. In normal skeletal muscle, syncoilin is concentrated at the neuromuscular junction(PMID: 11053421). Western blot analysis detected 64 kDa and 55 kDa syncoilin proteins in mouse heart(PMID: 11053421).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Invest Ophthalmol Vis Sci; The Cytoskeleton in the Extraocular Muscles of Desmin Knockout Mice.; Authors - Maria Angels Rodríguez

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

CHAO (Verified Customer) (03-31-2022)

Strong band around predicted size

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse Heart