SYNJ1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SYNJ1 Recombinant monoclonal antibody (87620-1-RR)

SYNJ1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87620-1-RR

Clone No.253047H8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

EC:3.1.3.36, INPP5G, KIAA0910, Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1, synaptojanin 1

• 

  WB analysis using 87620-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87620-1-RR (SYNJ1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87620-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87620-1-RR (SYNJ1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 87620-1-RR

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using SYNJ1 antibody (87620-1-RR, Clone: 253047H8 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, 37°C incubated rat brain tissue
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87620-1-RR targets SYNJ1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16588

  Product name: Recombinant human SYNJ1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 856-1125 aa of BC136603

  Sequence: PVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRPAPPQRPPPPS

• Full Name: synaptojanin 1
• Calculated Molecular Weight: 1612 aa, 178 kDa
• Observed Molecular Weight: 120-150 kDa
• GenBank Accession Number: BC136603
• Gene Symbol: SYNJ1
• Gene ID (NCBI): 8867
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43426
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Synaptojanin 1, a polyphosphoinositide phosphatase, is expressed as two major alternatively spliced isoforms of 145 kDa (SJ145) and 170 kDa (SJ170), which are thought to have pleiotropic roles in endocytosis, signaling, and actin function. SJ145 is highly enriched in nerve terminals where it participates in clathrin-dependent synaptic vesicle recycling. SJ170, which differs from SJ145 by the presence of a carboxy-terminal extension, is the predominant isoform in developing neurons and is expressed in a variety of tissues (PMID:10801423).