Synaptojanin 2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Synaptojanin 2 Polyclonal antibody (13893-1-AP)

Synaptojanin 2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13893-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

SYNJ2, Synaptojanin-2, Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 2, KIAA0348, INPP5H

• 

  WB analysis using 13893-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13893-1-AP (Synaptojanin 2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse small intestine using 13893-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 13893-1-AP (Synaptojanin 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 13893-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13893-1-AP (Synaptojanin 2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 13893-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 13893-1-AP (Synaptojanin 2 antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 13893-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Synaptojanin 2 antibody (13893-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Synaptojanin 2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells
• Positive IHC detected in: human brain tissue, mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13893-1-AP targets Synaptojanin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4855

  Product name: Recombinant human SYNJ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1147-1496 aa of BC043277

  Sequence: APQQPPKARTGISKPYNVKQIKTTNAQEAEAAIRCLLEARGGASEEALSAVAPRDLEASSEPEPTPGAAKPETPQAPPLLPRRPPPRVPAIKKPTLRRTGKPLSPEEQFEQQTVHFTIGPPETSVEAPPVVTAPRVPPVPKPRTFQPGKAAERPSHRKPASDEAPPGAGASVPPPLEAPPLVPKVPPRRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHGHKTLGHWVTISDQEKRTALQVFDPLAKT

• Full Name: synaptojanin 2
• Calculated Molecular Weight: 1496 aa, 166 kDa
• Observed Molecular Weight: 143, 160 kDa
• GenBank Accession Number: BC043277
• Gene Symbol: SYNJ2
• Gene ID (NCBI): 8871
• RRID: AB_2255784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15056
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SYNJ2(Synaptojanin-2) is also named as KIAA0348 and belongs to the synaptojanin family. SYNJ2 encodes an inositol polyphosphate phosphatase that functions in recycling neurotransmitter vesicles and is implicated in spermatogenesis(PMID: 24103750). This protein has 3 isoforms produced by alternative splicing.

Publications

What published studies show

Synaptojanin 2 (SYNJ2) polyclonal antibody (Cat# 13893-1-AP) has 6 citations published in Nature Metabolism, Neuron, Redox Biology, EMBO Journal, Frontiers in Cardiovascular Medicine, and Research Square. The associated research fields include mitochondrial biology and mitophagy, neuronal signaling, oxidative stress and neuroinflammation, cardiovascular disease, autophagy, and insulin metabolism.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Metab; Insulin signalling regulates Pink1 mRNA localization via modulation of AMPK activity to support PINK1 function in neurons; Authors - J Tabitha Hees
mouse	WB	Neuron; Neuronal mitochondria transport Pink1 mRNA via synaptojanin 2 to support local mitophagy.; Authors - Angelika B Harbauer
mouse	WB	Redox Biol; Synaptojanin-2-binding protein ameliorates oxidative stress, neuroinflammation and depression-like behaviors via SYNJ2/PIP(2)/IP(3) signaling pathway.; Authors - Wenjing Wang
human	WB	EMBO J; A unified mechanism for mitochondrial damage sensing in PINK1-Parkin-mediated mitophagy.; Authors - Julia A Thayer
mouse		Front Cardiovasc Med; Macrophages-Related Genes Biomarkers in the Deterioration of Atherosclerosis.; Authors - Yue Zheng
mouse	WB	Res Sq; Bipolar and schizophrenia risk gene AKAP11 encodes an autophagy receptor coupling the regulation of PKA kinase network homeostasis to synaptic transmission; Authors - You-Kyung Lee