SYNJ2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYNJ2 Polyclonal antibody, PBS Only (30391-1-PBS)

• 

  WB analysis using 30391-1-AP (same clone as 30391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30391-1-AP (SYNJ2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30391-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30391-1-AP (same clone as 30391-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30391-1-AP (SYNJ2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 30391-1-AP (same clone as 30391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30391-1-AP (SYNJ2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 30391-1-AP (same clone as 30391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30391-1-AP (SYNJ2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30391-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 30391-1-AP (same clone as 30391-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using SYNJ2 antibody (30391-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30391-1-PBS in a different storage buffer formulation.

SYNJ2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30391-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30391-1-PBS targets SYNJ2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33002

  Product name: Recombinant human SYNJ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 678-839 aa of BC043277

  Sequence: RRKKSAPAAFHLQVLQSNSQLLQGLTYNSSDSPSGHPPAAGTVFPQGDFLSTSSATSPDSDGTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHGHKTLGHWVTISDQEKRTALQVFDPLAKT

• Full Name: synaptojanin 2
• Calculated Molecular Weight: 1496 aa, 166 kDa
• Observed Molecular Weight: 143 kDa, 160 kDa
• GenBank Accession Number: BC043277
• Gene Symbol: SYNJ2
• Gene ID (NCBI): 8871
• RRID: AB_3086305
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15056
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SYNJ2(Synaptojanin-2) is also named as KIAA0348 and belongs to the synaptojanin family. SYNJ2 encodes an inositol polyphosphate phosphatase that functions in recycling neurotransmitter vesicles and is implicated in spermatogenesis(PMID: 24103750). This protein has 3 isoforms produced by alternative splicing.