SYNPO Polyclonal antibody

• 

  WB analysis using 29662-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29662-1-AP (SYNPO antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 29662-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using SYNPO antibody (29662-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of U2OS using 29662-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using SYNPO antibody (29662-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

SYNPO Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 29662-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

KIAA1029, synaptopodin, SYNPO

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

29662-1-AP targets SYNPO in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31287

  Product name: Recombinant human SYNPO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 336-510 aa of BC146665

  Sequence: SPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPS

• Full Name: synaptopodin
• Calculated Molecular Weight: 929 aa, 99 kDa
• Observed Molecular Weight: 44 kDa, 74-100 kDa
• GenBank Accession Number: BC146665
• Gene Symbol: SYNPO
• Gene ID (NCBI): 11346
• RRID: AB_3086150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3V7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Synaptopodin is a actin-associated protein expressed in mature dendritic spines and renal podocytes. Several isoforms of synaptopodin have been reported: the 100 kDa neural form and 110 kDa renal form. 44-45 kDa may represent the degradation product of synaptopodin. As a podocyte specific protein, synaptopodin expression level was decreased in kidney but increased in the urinary podocytes from patients with preeclampsia, indicating that synaptopodin is a useful marker for preeclampsia. (15841212, 10555072)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Arch Physiol Biochem; Huaiqihuang (HQH) protects podocytes from high glucose-induced apoptosis and inflammation response by regulating PI3K/AKT/mTOR pathway; Authors - Peipei Zhang